PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G009100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 294aa    MW: 32182.6 Da    PI: 7.57
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G009100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.95.7e-51261551128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lp+GfrFhPtdee+v++yL++k+ + ++ +  vi +vd++++ePw+Lp k+k +ekew+fF+++ +ky+tg+r+nrat+sgyWkatg+d+e
  Brast06G009100.1.p  26 LPAGFRFHPTDEEVVTHYLTPKALDGRFAC-VVIGDVDLNRSEPWELPGKAKMGEKEWFFFVHKGRKYPTGTRTNRATESGYWKATGRDRE 115
                         799************************999.78***************99999************************************** PP

                 NAM  92 vlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++    ++ lvglkktLvfy grap+g+kt Wvmhe+rl
  Brast06G009100.1.p 116 IFRGrgrSQVLVGLKKTLVFYLGRAPRGKKTPWVMHEFRL 155
                         **985545555***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-6021179IPR003441NAC domain
PROSITE profilePS5100556.226179IPR003441NAC domain
PfamPF023657.0E-2627155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSDVTAVMDL GAAAPAAPRR RQQLDLPAGF RFHPTDEEVV THYLTPKALD GRFACVVIGD  60
VDLNRSEPWE LPGKAKMGEK EWFFFVHKGR KYPTGTRTNR ATESGYWKAT GRDREIFRGR  120
GRSQVLVGLK KTLVFYLGRA PRGKKTPWVM HEFRLDGQLP ANLPPSAKDE WAVCRVFNKD  180
MAAAAKAAPA PAPQMAEAAA AMGMERSDSI ADFLDGFLLE QLPPLMDSPF DGASLEVKAE  240
QQNPSSSYFS LPAASTRAAG GDMGTASSSS SKLYLGLDDL DPLMDFSNDM WKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-502318314169NO APICAL MERISTEM PROTEIN
1ut4_B9e-502318314169NO APICAL MERISTEM PROTEIN
1ut7_A9e-502318314169NO APICAL MERISTEM PROTEIN
1ut7_B9e-502318314169NO APICAL MERISTEM PROTEIN
3swm_A1e-492318317172NAC domain-containing protein 19
3swm_B1e-492318317172NAC domain-containing protein 19
3swm_C1e-492318317172NAC domain-containing protein 19
3swm_D1e-492318317172NAC domain-containing protein 19
3swp_A1e-492318317172NAC domain-containing protein 19
3swp_B1e-492318317172NAC domain-containing protein 19
3swp_C1e-492318317172NAC domain-containing protein 19
3swp_D1e-492318317172NAC domain-containing protein 19
4dul_A9e-502318314169NAC domain-containing protein 19
4dul_B9e-502318314169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559780.11e-160PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ23e-79NC100_ARATH; NAC domain-containing protein 100
TrEMBLI1GR191e-160I1GR19_BRADI; Uncharacterized protein
STRINGBRADI1G17440.11e-159(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.14e-79NAC domain containing protein 80